Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YAL030W  from Saccharomyces cerevisiae S288C
>YAL030W|YAL030W SNC1 SGDID:S000000028, Chr I from 87286-87387,87501-87752, Genome Release 64-1-1, Verified ORF, "Vesicle membrane receptor protein (v-SNARE) involved in the fusion between Golgi-derived secretory vesicles with the plasma membrane; proposed to be involved in endocytosis; member of the synaptobrevin/VAMP family of R-type v-SNARE proteins" ORGANISM: Saccharomyces cerevisiae S288C (117 aa)
MSSSTPFDPYALSEHDEERPQNVQSKSRTAELQAEIDDTVGIMRDNINKVAERGERLTSI
EDKADNLAVSAQGFKRGANRVRKAMWYKDLKMKMCLALVIIILLVVIIVPIAVHFSR